Anti AAGAB pAb (ATL-HPA040174)

Atlas Antibodies

Catalog No.:
ATL-HPA040174-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: alpha- and gamma-adaptin binding protein
Gene Name: AAGAB
Alternative Gene Name: FLJ11506, p34
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037257: 90%, ENSRNOG00000008424: 90%
Entrez Gene ID: 79719
Uniprot ID: Q6PD74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GGASNTTDAQVDSIVDPMLDLDIQELASLTTGGGDVENFERLFSKLKEMKDKAATLPHEQRKVHAEKVAKAFWMAIG
Gene Sequence GGASNTTDAQVDSIVDPMLDLDIQELASLTTGGGDVENFERLFSKLKEMKDKAATLPHEQRKVHAEKVAKAFWMAIG
Gene ID - Mouse ENSMUSG00000037257
Gene ID - Rat ENSRNOG00000008424
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AAGAB pAb (ATL-HPA040174)
Datasheet Anti AAGAB pAb (ATL-HPA040174) Datasheet (External Link)
Vendor Page Anti AAGAB pAb (ATL-HPA040174) at Atlas Antibodies

Documents & Links for Anti AAGAB pAb (ATL-HPA040174)
Datasheet Anti AAGAB pAb (ATL-HPA040174) Datasheet (External Link)
Vendor Page Anti AAGAB pAb (ATL-HPA040174)
Citations for Anti AAGAB pAb (ATL-HPA040174) – 2 Found
Pohler, Elizabeth; Mamai, Ons; Hirst, Jennifer; Zamiri, Mozheh; Horn, Helen; Nomura, Toshifumi; Irvine, Alan D; Moran, Benvon; Wilson, Neil J; Smith, Frances J D; Goh, Christabelle S M; Sandilands, Aileen; Cole, Christian; Barton, Geoffrey J; Evans, Alan T; Shimizu, Hiroshi; Akiyama, Masashi; Suehiro, Mitsuhiro; Konohana, Izumi; Shboul, Mohammad; Teissier, Sebastien; Boussofara, Lobna; Denguezli, Mohamed; Saad, Ali; Gribaa, Moez; Dopping-Hepenstal, Patricia J; McGrath, John A; Brown, Sara J; Goudie, David R; Reversade, Bruno; Munro, Colin S; McLean, W H Irwin. Haploinsufficiency for AAGAB causes clinically heterogeneous forms of punctate palmoplantar keratoderma. Nature Genetics. 2012;44(11):1272-6.  PubMed
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed