Anti AAGAB pAb (ATL-HPA039371)

Atlas Antibodies

Catalog No.:
ATL-HPA039371-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: alpha- and gamma-adaptin binding protein
Gene Name: AAGAB
Alternative Gene Name: FLJ11506, p34
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037257: 78%, ENSRNOG00000008424: 81%
Entrez Gene ID: 79719
Uniprot ID: Q6PD74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KAQEWCIKHGFELVELSPEELPEEDDDFPESTGVKRIVQALNANVWSNVVMKNDRNQGFSLLNSLTGTNHSIGSADPCHPEQPHLPAAD
Gene Sequence KAQEWCIKHGFELVELSPEELPEEDDDFPESTGVKRIVQALNANVWSNVVMKNDRNQGFSLLNSLTGTNHSIGSADPCHPEQPHLPAAD
Gene ID - Mouse ENSMUSG00000037257
Gene ID - Rat ENSRNOG00000008424
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AAGAB pAb (ATL-HPA039371)
Datasheet Anti AAGAB pAb (ATL-HPA039371) Datasheet (External Link)
Vendor Page Anti AAGAB pAb (ATL-HPA039371) at Atlas Antibodies

Documents & Links for Anti AAGAB pAb (ATL-HPA039371)
Datasheet Anti AAGAB pAb (ATL-HPA039371) Datasheet (External Link)
Vendor Page Anti AAGAB pAb (ATL-HPA039371)