Anti AACS pAb (ATL-HPA058815)

Atlas Antibodies

SKU:
ATL-HPA058815-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
  • Immunofluorescent staining of human cell line MCF7 shows localization to vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: acetoacetyl-CoA synthetase
Gene Name: AACS
Alternative Gene Name: ACSF1, FLJ12389, SUR-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029482: 92%, ENSRNOG00000000967: 92%
Entrez Gene ID: 65985
Uniprot ID: Q86V21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVVGYLPNSEHAVEAMLAAASIGAIWSSTSPDFGVNGVLDRFSQIQPKLIFSVEAVVYNGKEHNHMEKLQQVVKGLPDLKKVVVI
Gene Sequence RVVGYLPNSEHAVEAMLAAASIGAIWSSTSPDFGVNGVLDRFSQIQPKLIFSVEAVVYNGKEHNHMEKLQQVVKGLPDLKKVVVI
Gene ID - Mouse ENSMUSG00000029482
Gene ID - Rat ENSRNOG00000000967
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AACS pAb (ATL-HPA058815)
Datasheet Anti AACS pAb (ATL-HPA058815) Datasheet (External Link)
Vendor Page Anti AACS pAb (ATL-HPA058815) at Atlas Antibodies

Documents & Links for Anti AACS pAb (ATL-HPA058815)
Datasheet Anti AACS pAb (ATL-HPA058815) Datasheet (External Link)
Vendor Page Anti AACS pAb (ATL-HPA058815)