Anti A2M pAb (ATL-HPA002265)

Atlas Antibodies

SKU: ATL-HPA002265-25

• 
• 

Protein Description: alpha-2-macroglobulin
Gene Name: A2M
Alternative Gene Name: CPAMD5, FWP007, S863-7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030111: 53%, ENSRNOG00000045772: 52%
Entrez Gene ID: 2
Uniprot ID: P01023
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVLLMKPDAELSASSVYNLLPEKDLTGFPGPLNDQDDEDCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTETVRKYFPETWIWDLVVVNS
• Gene Sequence: SVLLMKPDAELSASSVYNLLPEKDLTGFPGPLNDQDDEDCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTETVRKYFPETWIWDLVVVNS
• Gene ID - Mouse: ENSMUSG00000030111
• Gene ID - Rat: ENSRNOG00000045772
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti A2M pAb (ATL-HPA002265) – 5 Found

Häggmark, Anna; Neiman, Maja; Drobin, Kimi; Zwahlen, Martin; Uhlén, Mathias; Nilsson, Peter; Schwenk, Jochen M. Classification of protein profiles from antibody microarrays using heat and detergent treatment. New Biotechnology. 2012;29(5):564-70. 

Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. 

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. 

Jaldín-Fincati, Javier R; Actis Dato, Virginia; Díaz, Nicolás M; Sánchez, María C; Barcelona, Pablo F; Chiabrando, Gustavo A. Activated α(2)-Macroglobulin Regulates LRP1 Levels at the Plasma Membrane through the Activation of a Rab10-dependent Exocytic Pathway in Retinal Müller Glial Cells. Scientific Reports. 2019;9(1):13234. 

Yang, Andrew C; Vest, Ryan T; Kern, Fabian; Lee, Davis P; Agam, Maayan; Maat, Christina A; Losada, Patricia M; Chen, Michelle B; Schaum, Nicholas; Khoury, Nathalie; Toland, Angus; Calcuttawala, Kruti; Shin, Heather; Pálovics, Róbert; Shin, Andrew; Wang, Elizabeth Y; Luo, Jian; Gate, David; Schulz-Schaeffer, Walter J; Chu, Pauline; Siegenthaler, Julie A; McNerney, M Windy; Keller, Andreas; Wyss-Coray, Tony. A human brain vascular atlas reveals diverse mediators of Alzheimer's risk. Nature. 2022;603(7903):885-892.