Anti A1BG pAb (ATL-HPA044252)

Atlas Antibodies

Catalog No.:
ATL-HPA044252-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: alpha-1-B glycoprotein
Gene Name: A1BG
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022347: 35%, ENSRNOG00000004692: 37%
Entrez Gene ID: 1
Uniprot ID: P04217
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SESLLKPLANVTLTCQARLETPDFQLFKNGVAQEPVHLDSPAIKHQFLLTGDTQGRYRCRSGLSTGWTQLSKLLELTGPKSLPAPWLSM
Gene Sequence SESLLKPLANVTLTCQARLETPDFQLFKNGVAQEPVHLDSPAIKHQFLLTGDTQGRYRCRSGLSTGWTQLSKLLELTGPKSLPAPWLSM
Gene ID - Mouse ENSMUSG00000022347
Gene ID - Rat ENSRNOG00000004692
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti A1BG pAb (ATL-HPA044252)
Datasheet Anti A1BG pAb (ATL-HPA044252) Datasheet (External Link)
Vendor Page Anti A1BG pAb (ATL-HPA044252) at Atlas Antibodies

Documents & Links for Anti A1BG pAb (ATL-HPA044252)
Datasheet Anti A1BG pAb (ATL-HPA044252) Datasheet (External Link)
Vendor Page Anti A1BG pAb (ATL-HPA044252)