Anti A1BG pAb (ATL-HPA044252)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044252-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: A1BG
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022347: 35%, ENSRNOG00000004692: 37%
Entrez Gene ID: 1
Uniprot ID: P04217
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SESLLKPLANVTLTCQARLETPDFQLFKNGVAQEPVHLDSPAIKHQFLLTGDTQGRYRCRSGLSTGWTQLSKLLELTGPKSLPAPWLSM |
| Gene Sequence | SESLLKPLANVTLTCQARLETPDFQLFKNGVAQEPVHLDSPAIKHQFLLTGDTQGRYRCRSGLSTGWTQLSKLLELTGPKSLPAPWLSM |
| Gene ID - Mouse | ENSMUSG00000022347 |
| Gene ID - Rat | ENSRNOG00000004692 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti A1BG pAb (ATL-HPA044252) | |
| Datasheet | Anti A1BG pAb (ATL-HPA044252) Datasheet (External Link) |
| Vendor Page | Anti A1BG pAb (ATL-HPA044252) at Atlas Antibodies |
| Documents & Links for Anti A1BG pAb (ATL-HPA044252) | |
| Datasheet | Anti A1BG pAb (ATL-HPA044252) Datasheet (External Link) |
| Vendor Page | Anti A1BG pAb (ATL-HPA044252) |