Visit our Neurodegeneration Products homepage to browse related research products
Click here for the Neuroscience Products Dashboard PageRecombinant Protein / Amyloid beta peptide 40 (A Beta40)
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Warning: Store at 4°C. After reconstituted, store no longer than 1-2 days at 4°C, unless preservative is added.For long term storage, aliquot and store reconstituted product frozen at -20°C or lower. Aliquot to avoid cycles of freeze/thaw.
| Documents & Links for Amyloid Beta Peptide 40 | |
| Datasheet | csr-kn-toyu-m03_amyloid-beta-peptide-40-abeta40_datasheet.pdf |
| Vendor Page | Amyloid Beta Peptide 40 at Cosmo Bio LTD |
| Documents & Links for Amyloid Beta Peptide 40 | |
| Datasheet | csr-kn-toyu-m03_amyloid-beta-peptide-40-abeta40_datasheet.pdf |
| Vendor Page | Amyloid Beta Peptide 40 |