Amyloid Beta Peptide 40
Cosmo Bio
- Catalog No.:
- CSR-KN-TOYU-M03
- Shipping:
- Calculated at Checkout
$503.00
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Warning: Store at 4°C. After reconstituted, store no longer than 1-2 days at 4°C, unless preservative is added.For long term storage, aliquot and store reconstituted product frozen at -20°C or lower. Aliquot to avoid cycles of freeze/thaw.
| Documents & Links for Amyloid Beta Peptide 40 | |
| Datasheet | Amyloid Beta Peptide 40 Datasheet |
| Documents & Links for Amyloid Beta Peptide 40 | |
| Datasheet | Amyloid Beta Peptide 40 Datasheet |