Add to Cart The item has been added Recombinant Human Calcium-binding protein 39(CAB39) (CSB-EP640939HU) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,062.00 View
Add to Cart The item has been added Recombinant Human NACHT, LRR and PYD domains-containing protein 3 (NLRP3) (C279A), partial (CSB-EP822275HU7(M1)) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View
Add to Cart The item has been added Recombinant Escherichia coli Colicin-Ia (cia) (626:I→I-GFTFSNYAMSWVRQAPGKGLEWVSSQQYNSYPYT) (CSB-EP361926ENLe1(M)) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,632.00 View
Add to Cart The item has been added Recombinant Mouse Growth/differentiation factor 9 (Gdf9) (CSB-EP009352MO) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $1,812.00 View
Add to Cart The item has been added Recombinant Mouse Growth/differentiation factor 11 (Gdf11) (CSB-EP009344MO) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $1,812.00 View
Add to Cart The item has been added Recombinant Mouse Bone morphogenetic protein 4 (Bmp4) (CSB-EP002740MO) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,062.00 View
Add to Cart The item has been added Recombinant Mouse Bone morphogenetic protein 15 (Bmp15) (CSB-EP002735MO) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,062.00 View
Add to Cart The item has been added Recombinant Human Neuronal acetylcholine receptor subunit alpha-3 (CHRNA3), partial (CSB-EP005389HU1d7) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $1,812.00 View
Add to Cart The item has been added Recombinant Human GTPase KRas (KRAS) (G12C), partial (CSB-EP012493HU(F2)(M1)b0) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View
Add to Cart The item has been added Recombinant Human Integrin alpha-M (ITGAM), partial (CSB-EP011876HUc7) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View
Add to Cart The item has been added Recombinant Mouse Sorcin (Sri) (CSB-EP022665MO) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $1,812.00 View
Add to Cart The item has been added Recombinant Pig Uricase (UOX) (CSB-EP025648PIc7) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View
Add to Cart The item has been added Recombinant Stenotrophomonas maltophilia Dicamba O-demethylase, oxygenase component (ddmC) (CSB-EP7065SLU) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View
Add to Cart The item has been added Recombinant Human Histamine H4 receptor (HRH4), partial (CSB-EP887972HU1a0) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,062.00 View
Add to Cart The item has been added Recombinant Human GTP-binding protein GEM (GEM) (CSB-MP009362HU) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,490.00 View
Add to Cart The item has been added Recombinant Human DDB1-and CUL4-associated factor 1 (DCAF1), partial (CSB-EP896722HU1c7) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $1,812.00 View
Add to Cart The item has been added Recombinant Human Mitochondrial-processing peptidase subunit alpha (PMPCA) (CSB-EP606021HU) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View
Add to Cart The item has been added Recombinant Mouse Galectin-9 (Lgals9) (CSB-EP012895MO) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $1,812.00 View
Add to Cart The item has been added Recombinant Human Sorcin (SRI) (CSB-EP022665HUf0) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $1,812.00 View
Add to Cart The item has been added Recombinant Human Sigma non-opioid intracellular receptor 1 (SIGMAR1), partial (CSB-EP021320HUa0) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,062.00 View
Add to Cart The item has been added Recombinant Human ATP-dependent RNA helicase DDX3X (DDX3X) (CSB-EP006621HUd7) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $1,812.00 View
Add to Cart The item has been added Recombinant Human ATP-dependent RNA helicase DDX3X (DDX3X) (CSB-EP006621HUc7) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $1,812.00 View
Add to Cart The item has been added Recombinant Human Nucleoplasmin-2 (NPM2) (CSB-EP774790HU) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,062.00 View
Add to Cart The item has been added Recombinant Rat Collagenase 3 (Mmp13) (CSB-EP014660RA) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,062.00 View
Add to Cart The item has been added Recombinant Human Heparanase (HPSE), partial (CSB-EP010716HUc7) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,062.00 View
Add to Cart The item has been added Recombinant Human Epithelial membrane protein 2 (EMP2), partial (CSB-EP007649HU1) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View
Add to Cart The item has been added Recombinant Human Cyclin-dependent kinase 12 (CDK12), partial (CSB-EP882147HUb0) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,062.00 View
Add to Cart The item has been added Recombinant Human Forkhead box protein C1 (FOXC1) (CSB-EP618640HUc7) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View
Add to Cart The item has been added Recombinant Mouse Perilipin-2 (Plin2) (CSB-EP337564MO) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View
Add to Cart The item has been added Recombinant Cat Zona pellucida sperm-binding protein 3 (ZP3) (CSB-EP027121CA) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,062.00 View