Add to Cart The item has been added Recombinant Glycine max Stress-induced protein SAM22 (PR-10) (CSB-EP333215GGV) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View
Add to Cart The item has been added Recombinant Human Low-density lipoprotein receptor (LDLR), partial (CSB-EP012846HU) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View
Add to Cart The item has been added Recombinant Mouse Sarcosine dehydrogenase, mitochondrial (Sardh), partial (CSB-EP857487MO) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View
Add to Cart The item has been added Recombinant Danio rerio Aerolysin-like protein (LOC795232) (CSB-EP6621DIL) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,062.00 View
Add to Cart The item has been added Recombinant Mouse Adenosine receptor A2a (Adora2a), partial (CSB-EP720158MO1) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $1,812.00 View
Add to Cart The item has been added Recombinant Enterobacteria phage T4 Highly immunogenic outer capsid protein (hoc) (CSB-EP323826EDZ) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View
Add to Cart The item has been added Recombinant Mouse Growth/differentiation factor 9 (Gdf9) (CSB-MP009352MO) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $3,168.00 View
Add to Cart The item has been added Recombinant Mouse Tumor necrosis factor ligand superfamily member 12 (Tnfsf12), partial (CSB-MP023987MO1) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $3,520.00 View
Add to Cart The item has been added Recombinant Human Heterogeneous nuclear ribonucleoproteins A2/B1 (HNRNPA2B1), partial (CSB-EP2576HU1) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View
Add to Cart The item has been added Recombinant Human Eukaryotic elongation factor 2 kinase (EEF2K) (CSB-EP007435HU) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,062.00 View
Add to Cart The item has been added Recombinant Human TLR adapter interacting with SLC15A4 on the lysosome (TASL) (CSB-EP867184HU) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View
Add to Cart The item has been added Recombinant Bovine Interleukin-4 (IL4) (CSB-EP011659BO) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,062.00 View
Add to Cart The item has been added Recombinant Mouse Sarcosine dehydrogenase, mitochondrial (Sardh), partial (CSB-EP857487MOb1) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View
Add to Cart The item has been added Recombinant Human Kelch-like protein 32 (KLHL32) (CSB-EP853471HU) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View
Add to Cart The item has been added Recombinant Human Adhesion G protein-coupled receptor L3 (ADGRL3), partial (CSB-EP867185HU) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,062.00 View
Add to Cart The item has been added Recombinant Human Fibroblast growth factor 1 (FGF1) (CSB-EP008615HUa0) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $1,812.00 View
Add to Cart The item has been added Recombinant Human Fatty acid synthase (FASN), partial (CSB-EP008435HU1) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $1,812.00 View
Add to Cart The item has been added Recombinant Human UDP-glucuronosyltransferase 3A2 (UGT3A2), partial (CSB-EP667485HU) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,062.00 View
Add to Cart The item has been added Recombinant Escherichia coli Colicin-Ia (cia) (626:I→I-QGISSRLAWYQQKPEKAPKSLIYARSPWGYYLDS) (CSB-EP361926ENLe1(M2)) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,632.00 View
Add to Cart The item has been added Recombinant Human Neurosecretory protein VGF (VGF) (CSB-EP025847HUc7) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View
Add to Cart The item has been added Recombinant Mouse Endoplasmic reticulum chaperone BiP (Hspa5) (CSB-EP010827MOc7) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View
Add to Cart The item has been added Recombinant Mouse Indian hedgehog protein (Ihh), partial (CSB-EP011569MO) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,062.00 View
Add to Cart The item has been added Recombinant Mouse Fibroblast growth factor 21 (Fgf21) (CSB-EP008627MOc7) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View
Add to Cart The item has been added Recombinant Human Transforming growth factor beta regulator 1 (TBRG1) (CSB-EP023243HU) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View
Add to Cart The item has been added Recombinant Rat DNA polymerase beta (Polb) (CSB-EP018302RA) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View
Add to Cart The item has been added Recombinant Human Glutathione S-transferase kappa 1 (GSTK1), partial (CSB-EP009978HUf0) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $1,812.00 View
Add to Cart The item has been added Recombinant Human Large ribosomal subunit protein eL31 (RPL31) (CSB-EP020227HU) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $1,812.00 View
Add to Cart The item has been added Recombinant Brassica napus Napin-1A, partial (CSB-EP338607BWD) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View
Add to Cart The item has been added Recombinant Human DNA polymerase beta (POLB) (CSB-EP018302HU) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $1,812.00 View
Add to Cart The item has been added Recombinant Mouse Cytochrome c1, heme protein, mitochondrial (Cyc1), partial (CSB-EP875175MO1) CUSABIO MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: $2,466.00 View