PrEST Antigen ZNF555 (ATL-APrEST85830)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST85830-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: ZNF555
Alternative Gene Name: MGC26707
Sequence: GEALSQIPHLNLYKKIPPGVKQYEYNTYGKVFMHRRTSLKSPITVHTGHKPY
Interspecies mouse/rat: ENSMUSG00000074735: 48%, ENSRNOG00000048894: 46%
Entrez Gene ID: 148254
Uniprot ID: Q8NEP9
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | GEALSQIPHLNLYKKIPPGVKQYEYNTYGKVFMHRRTSLKSPITVHTGHKPY |
Gene ID - Mouse | ENSMUSG00000074735 |
Gene ID - Rat | ENSRNOG00000048894 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen ZNF555 (ATL-APrEST85830) | |
Datasheet | PrEST Antigen ZNF555 (ATL-APrEST85830) Datasheet (External Link) |
Vendor Page | PrEST Antigen ZNF555 (ATL-APrEST85830) at Atlas Antibodies |
Documents & Links for PrEST Antigen ZNF555 (ATL-APrEST85830) | |
Datasheet | PrEST Antigen ZNF555 (ATL-APrEST85830) Datasheet (External Link) |
Vendor Page | PrEST Antigen ZNF555 (ATL-APrEST85830) |