PrEST Antigen ZBTB1 (ATL-APrEST85457)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST85457-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: ZBTB1
Alternative Gene Name: KIAA0997, ZNF909
Sequence: CDSCGFGFSCEKLLDEHVLTCTNRHLYQNTRSYHRIVDIRDGKDSNIKAEFGEKDSSKTFSAQTDKYRGDTSQAADDSASTTGSRK
Interspecies mouse/rat: ENSMUSG00000033454: 89%, ENSRNOG00000058593: 79%
Entrez Gene ID: 22890
Uniprot ID: Q9Y2K1
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | CDSCGFGFSCEKLLDEHVLTCTNRHLYQNTRSYHRIVDIRDGKDSNIKAEFGEKDSSKTFSAQTDKYRGDTSQAADDSASTTGSRK |
| Gene ID - Mouse | ENSMUSG00000033454 |
| Gene ID - Rat | ENSRNOG00000058593 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen ZBTB1 (ATL-APrEST85457) | |
| Datasheet | PrEST Antigen ZBTB1 (ATL-APrEST85457) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZBTB1 (ATL-APrEST85457) at Atlas Antibodies |
| Documents & Links for PrEST Antigen ZBTB1 (ATL-APrEST85457) | |
| Datasheet | PrEST Antigen ZBTB1 (ATL-APrEST85457) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZBTB1 (ATL-APrEST85457) |