PrEST Antigen UBE2G1 (ATL-APrEST84562)
Atlas Antibodies
- SKU:
- ATL-APrEST84562-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: UBE2G1
Alternative Gene Name: UBC7, UBE2G
Sequence: RWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVA
Interspecies mouse/rat: ENSMUSG00000020794: 100%, ENSRNOG00000010041: 100%
Entrez Gene ID: 7326
Uniprot ID: P62253
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | RWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVA |
Gene ID - Mouse | ENSMUSG00000020794 |
Gene ID - Rat | ENSRNOG00000010041 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen UBE2G1 (ATL-APrEST84562) | |
Datasheet | PrEST Antigen UBE2G1 (ATL-APrEST84562) Datasheet (External Link) |
Vendor Page | PrEST Antigen UBE2G1 (ATL-APrEST84562) at Atlas Antibodies |
Documents & Links for PrEST Antigen UBE2G1 (ATL-APrEST84562) | |
Datasheet | PrEST Antigen UBE2G1 (ATL-APrEST84562) Datasheet (External Link) |
Vendor Page | PrEST Antigen UBE2G1 (ATL-APrEST84562) |