PrEST Antigen UBE2C (ATL-APrEST87700)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST87700-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: UBE2C
Alternative Gene Name: UBCH10
Sequence: GPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVD
Interspecies mouse/rat: ENSMUSG00000001403: 98%, ENSRNOG00000015131: 100%
Entrez Gene ID: 11065
Uniprot ID: O00762
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | GPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVD |
| Gene ID - Mouse | ENSMUSG00000001403 |
| Gene ID - Rat | ENSRNOG00000015131 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen UBE2C (ATL-APrEST87700) | |
| Datasheet | PrEST Antigen UBE2C (ATL-APrEST87700) Datasheet (External Link) |
| Vendor Page | PrEST Antigen UBE2C (ATL-APrEST87700) at Atlas Antibodies |
| Documents & Links for PrEST Antigen UBE2C (ATL-APrEST87700) | |
| Datasheet | PrEST Antigen UBE2C (ATL-APrEST87700) Datasheet (External Link) |
| Vendor Page | PrEST Antigen UBE2C (ATL-APrEST87700) |