PrEST Antigen TMPRSS9 (ATL-APrEST85771)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST85771-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: TMPRSS9
Alternative Gene Name:
Sequence: LEEELLQRGIRARLREHGISLAAYGTIVSAELTGRHKGPLAERDFKSGRCPGNSFSCGNSQCVTKVNPECD
Interspecies mouse/rat: ENSMUSG00000059406: 70%, ENSRNOG00000032429: 69%
Entrez Gene ID: 360200
Uniprot ID: Q7Z410
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | LEEELLQRGIRARLREHGISLAAYGTIVSAELTGRHKGPLAERDFKSGRCPGNSFSCGNSQCVTKVNPECD |
| Gene ID - Mouse | ENSMUSG00000059406 |
| Gene ID - Rat | ENSRNOG00000032429 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen TMPRSS9 (ATL-APrEST85771) | |
| Datasheet | PrEST Antigen TMPRSS9 (ATL-APrEST85771) Datasheet (External Link) |
| Vendor Page | PrEST Antigen TMPRSS9 (ATL-APrEST85771) at Atlas Antibodies |
| Documents & Links for PrEST Antigen TMPRSS9 (ATL-APrEST85771) | |
| Datasheet | PrEST Antigen TMPRSS9 (ATL-APrEST85771) Datasheet (External Link) |
| Vendor Page | PrEST Antigen TMPRSS9 (ATL-APrEST85771) |