PrEST Antigen TLR4 (ATL-APrEST87531)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST87531-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: TLR4
Alternative Gene Name: ARMD10, CD284, hToll, TLR-4
Sequence: LQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATP
Interspecies mouse/rat: ENSMUSG00000039005: 64%, ENSRNOG00000010522: 62%
Entrez Gene ID: 7099
Uniprot ID: O00206
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | LQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATP |
| Gene ID - Mouse | ENSMUSG00000039005 |
| Gene ID - Rat | ENSRNOG00000010522 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen TLR4 (ATL-APrEST87531) | |
| Datasheet | PrEST Antigen TLR4 (ATL-APrEST87531) Datasheet (External Link) |
| Vendor Page | PrEST Antigen TLR4 (ATL-APrEST87531) at Atlas Antibodies |
| Documents & Links for PrEST Antigen TLR4 (ATL-APrEST87531) | |
| Datasheet | PrEST Antigen TLR4 (ATL-APrEST87531) Datasheet (External Link) |
| Vendor Page | PrEST Antigen TLR4 (ATL-APrEST87531) |