PrEST Antigen TBCC (ATL-APrEST87104)
Atlas Antibodies
- SKU:
- ATL-APrEST87104-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: TBCC
Alternative Gene Name: CFC
Sequence: MESVSCSAAAVRTGDMESQRDLSLVPERLQRREQERQLEVERRKQKRQNQEVEKENSHFFVATFVRERAAVEELLERAESVERL
Interspecies mouse/rat: ENSMUSG00000036430: 70%, ENSRNOG00000048291: 69%
Entrez Gene ID: 6903
Uniprot ID: Q15814
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | MESVSCSAAAVRTGDMESQRDLSLVPERLQRREQERQLEVERRKQKRQNQEVEKENSHFFVATFVRERAAVEELLERAESVERL |
Gene ID - Mouse | ENSMUSG00000036430 |
Gene ID - Rat | ENSRNOG00000048291 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen TBCC (ATL-APrEST87104) | |
Datasheet | PrEST Antigen TBCC (ATL-APrEST87104) Datasheet (External Link) |
Vendor Page | PrEST Antigen TBCC (ATL-APrEST87104) at Atlas Antibodies |
Documents & Links for PrEST Antigen TBCC (ATL-APrEST87104) | |
Datasheet | PrEST Antigen TBCC (ATL-APrEST87104) Datasheet (External Link) |
Vendor Page | PrEST Antigen TBCC (ATL-APrEST87104) |