PrEST Antigen SPRY1 (ATL-APrEST87581)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST87581-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: SPRY1
Alternative Gene Name: hSPRY1
Sequence: PRTAPRQEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSPP
Interspecies mouse/rat: ENSMUSG00000037211: 77%, ENSRNOG00000025371: 74%
Entrez Gene ID: 10252
Uniprot ID: O43609
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | PRTAPRQEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSPP |
Gene ID - Mouse | ENSMUSG00000037211 |
Gene ID - Rat | ENSRNOG00000025371 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen SPRY1 (ATL-APrEST87581) | |
Datasheet | PrEST Antigen SPRY1 (ATL-APrEST87581) Datasheet (External Link) |
Vendor Page | PrEST Antigen SPRY1 (ATL-APrEST87581) at Atlas Antibodies |
Documents & Links for PrEST Antigen SPRY1 (ATL-APrEST87581) | |
Datasheet | PrEST Antigen SPRY1 (ATL-APrEST87581) Datasheet (External Link) |
Vendor Page | PrEST Antigen SPRY1 (ATL-APrEST87581) |