PrEST Antigen SLC16A6 (ATL-APrEST85375)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST85375-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: SLC16A6
Alternative Gene Name: MCT6, MCT7
Sequence: PASPKIVIQENRKEAQYMLENEKTRTSIDSIDSGVELTTSPKNVPTHTNLELEPKADMQQVLVKTSPRPSEKKAPLL
Interspecies mouse/rat: ENSMUSG00000041920: 68%, ENSRNOG00000000245: 65%
Entrez Gene ID: 9120
Uniprot ID: O15403
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | PASPKIVIQENRKEAQYMLENEKTRTSIDSIDSGVELTTSPKNVPTHTNLELEPKADMQQVLVKTSPRPSEKKAPLL |
| Gene ID - Mouse | ENSMUSG00000041920 |
| Gene ID - Rat | ENSRNOG00000000245 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen SLC16A6 (ATL-APrEST85375) | |
| Datasheet | PrEST Antigen SLC16A6 (ATL-APrEST85375) Datasheet (External Link) |
| Vendor Page | PrEST Antigen SLC16A6 (ATL-APrEST85375) at Atlas Antibodies |
| Documents & Links for PrEST Antigen SLC16A6 (ATL-APrEST85375) | |
| Datasheet | PrEST Antigen SLC16A6 (ATL-APrEST85375) Datasheet (External Link) |
| Vendor Page | PrEST Antigen SLC16A6 (ATL-APrEST85375) |