PrEST Antigen SIRPB1 (ATL-APrEST84979)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST84979-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: SIRPB1
Alternative Gene Name: CD172b, SIRP-BETA-1
Sequence: VSKSYALEISAHQKEHGSDITHEPALAPTAPL
Interspecies mouse/rat: ENSMUSG00000030374: 34%, ENSRNOG00000000040: 34%
Entrez Gene ID: 10326
Uniprot ID: O00241
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | VSKSYALEISAHQKEHGSDITHEPALAPTAPL |
Gene ID - Mouse | ENSMUSG00000030374 |
Gene ID - Rat | ENSRNOG00000000040 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen SIRPB1 (ATL-APrEST84979) | |
Datasheet | PrEST Antigen SIRPB1 (ATL-APrEST84979) Datasheet (External Link) |
Vendor Page | PrEST Antigen SIRPB1 (ATL-APrEST84979) at Atlas Antibodies |
Documents & Links for PrEST Antigen SIRPB1 (ATL-APrEST84979) | |
Datasheet | PrEST Antigen SIRPB1 (ATL-APrEST84979) Datasheet (External Link) |
Vendor Page | PrEST Antigen SIRPB1 (ATL-APrEST84979) |