PrEST Antigen SIK1 (ATL-APrEST87281)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST87281-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: SIK1
Alternative Gene Name: msk, SNF1LK
Sequence: YLLLERLKEYRNAQCARPGPARQPRPRSSDLSGLEVPQEGLSTDPFRPALLCPQPQTLVQSVLQAEMDCELQSSLQWPLFFPVDASCSGVF
Interspecies mouse/rat: ENSMUSG00000024042: 71%, ENSRNOG00000001189: 71%
Entrez Gene ID: 150094
Uniprot ID: P57059
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | YLLLERLKEYRNAQCARPGPARQPRPRSSDLSGLEVPQEGLSTDPFRPALLCPQPQTLVQSVLQAEMDCELQSSLQWPLFFPVDASCSGVF |
| Gene ID - Mouse | ENSMUSG00000024042 |
| Gene ID - Rat | ENSRNOG00000001189 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen SIK1 (ATL-APrEST87281) | |
| Datasheet | PrEST Antigen SIK1 (ATL-APrEST87281) Datasheet (External Link) |
| Vendor Page | PrEST Antigen SIK1 (ATL-APrEST87281) at Atlas Antibodies |
| Documents & Links for PrEST Antigen SIK1 (ATL-APrEST87281) | |
| Datasheet | PrEST Antigen SIK1 (ATL-APrEST87281) Datasheet (External Link) |
| Vendor Page | PrEST Antigen SIK1 (ATL-APrEST87281) |