PrEST Antigen RSL24D1 (ATL-APrEST87989)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST87989-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: RSL24D1
Alternative Gene Name: C15orf15, HRP-L30-iso, L30, RPL24, RPL24L
Sequence: QRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIH
Interspecies mouse/rat: ENSMUSG00000032215: 100%, ENSRNOG00000052787: 98%
Entrez Gene ID: 51187
Uniprot ID: Q9UHA3
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | QRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIH |
| Gene ID - Mouse | ENSMUSG00000032215 |
| Gene ID - Rat | ENSRNOG00000052787 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen RSL24D1 (ATL-APrEST87989) | |
| Datasheet | PrEST Antigen RSL24D1 (ATL-APrEST87989) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RSL24D1 (ATL-APrEST87989) at Atlas Antibodies |
| Documents & Links for PrEST Antigen RSL24D1 (ATL-APrEST87989) | |
| Datasheet | PrEST Antigen RSL24D1 (ATL-APrEST87989) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RSL24D1 (ATL-APrEST87989) |