PrEST Antigen RRN3 (ATL-APrEST85295)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST85295-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: RRN3
Alternative Gene Name: DKFZp566E104
Sequence: KDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSSSV
Interspecies mouse/rat: ENSMUSG00000022682: 85%, ENSRNOG00000003326: 85%
Entrez Gene ID: 54700
Uniprot ID: Q9NYV6
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | KDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSSSV |
| Gene ID - Mouse | ENSMUSG00000022682 |
| Gene ID - Rat | ENSRNOG00000003326 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen RRN3 (ATL-APrEST85295) | |
| Datasheet | PrEST Antigen RRN3 (ATL-APrEST85295) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RRN3 (ATL-APrEST85295) at Atlas Antibodies |
| Documents & Links for PrEST Antigen RRN3 (ATL-APrEST85295) | |
| Datasheet | PrEST Antigen RRN3 (ATL-APrEST85295) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RRN3 (ATL-APrEST85295) |