PrEST Antigen RAB5C (ATL-APrEST86406)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST86406-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: RAB5C
Alternative Gene Name: RAB5CL, RABL
Sequence: NSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
Interspecies mouse/rat: ENSMUSG00000019173: 95%, ENSRNOG00000018568: 97%
Entrez Gene ID: 5878
Uniprot ID: P51148
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | NSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN |
| Gene ID - Mouse | ENSMUSG00000019173 |
| Gene ID - Rat | ENSRNOG00000018568 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen RAB5C (ATL-APrEST86406) | |
| Datasheet | PrEST Antigen RAB5C (ATL-APrEST86406) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RAB5C (ATL-APrEST86406) at Atlas Antibodies |
| Documents & Links for PrEST Antigen RAB5C (ATL-APrEST86406) | |
| Datasheet | PrEST Antigen RAB5C (ATL-APrEST86406) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RAB5C (ATL-APrEST86406) |