PrEST Antigen RAB30 (ATL-APrEST85531)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST85531-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: RAB30
Alternative Gene Name:
Sequence: RSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVG
Interspecies mouse/rat: ENSMUSG00000030643: 100%, ENSRNOG00000010224: 100%
Entrez Gene ID: 27314
Uniprot ID: Q15771
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | RSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVG |
Gene ID - Mouse | ENSMUSG00000030643 |
Gene ID - Rat | ENSRNOG00000010224 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen RAB30 (ATL-APrEST85531) | |
Datasheet | PrEST Antigen RAB30 (ATL-APrEST85531) Datasheet (External Link) |
Vendor Page | PrEST Antigen RAB30 (ATL-APrEST85531) at Atlas Antibodies |
Documents & Links for PrEST Antigen RAB30 (ATL-APrEST85531) | |
Datasheet | PrEST Antigen RAB30 (ATL-APrEST85531) Datasheet (External Link) |
Vendor Page | PrEST Antigen RAB30 (ATL-APrEST85531) |