PrEST Antigen RAB19 (ATL-APrEST85096)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST85096-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: RAB19
Alternative Gene Name: RAB19B
Sequence: LIGNKCDLWEKRHVLFEDACTLAEKYGLLAVLETSAKES
Interspecies mouse/rat: ENSMUSG00000029923: 95%, ENSRNOG00000009030: 97%
Entrez Gene ID: 401409
Uniprot ID: A4D1S5
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | LIGNKCDLWEKRHVLFEDACTLAEKYGLLAVLETSAKES |
| Gene ID - Mouse | ENSMUSG00000029923 |
| Gene ID - Rat | ENSRNOG00000009030 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen RAB19 (ATL-APrEST85096) | |
| Datasheet | PrEST Antigen RAB19 (ATL-APrEST85096) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RAB19 (ATL-APrEST85096) at Atlas Antibodies |
| Documents & Links for PrEST Antigen RAB19 (ATL-APrEST85096) | |
| Datasheet | PrEST Antigen RAB19 (ATL-APrEST85096) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RAB19 (ATL-APrEST85096) |