PrEST Antigen PPIH (ATL-APrEST86285)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST86285-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: PPIH
Alternative Gene Name: CYP-20, CYPH, MGC5016, SnuCyp-20, USA-CYP
Sequence: VFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
Interspecies mouse/rat: ENSMUSG00000033036: 100%, ENSRNOG00000008489: 100%
Entrez Gene ID: 10465
Uniprot ID: O43447
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | VFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM |
Gene ID - Mouse | ENSMUSG00000033036 |
Gene ID - Rat | ENSRNOG00000008489 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen PPIH (ATL-APrEST86285) | |
Datasheet | PrEST Antigen PPIH (ATL-APrEST86285) Datasheet (External Link) |
Vendor Page | PrEST Antigen PPIH (ATL-APrEST86285) at Atlas Antibodies |
Documents & Links for PrEST Antigen PPIH (ATL-APrEST86285) | |
Datasheet | PrEST Antigen PPIH (ATL-APrEST86285) Datasheet (External Link) |
Vendor Page | PrEST Antigen PPIH (ATL-APrEST86285) |