PrEST Antigen OR2T1 (ATL-APrEST84625)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST84625-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: OR2T1
Alternative Gene Name: OR1-25
Sequence: PWECYHLIWKILPYIGTTVGSMEEYNTSSTDFTFMGLFNRKETS
Interspecies mouse/rat: ENSMUSG00000072707: 43%, ENSRNOG00000006734: 48%
Entrez Gene ID: 26696
Uniprot ID: O43869
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | PWECYHLIWKILPYIGTTVGSMEEYNTSSTDFTFMGLFNRKETS |
| Gene ID - Mouse | ENSMUSG00000072707 |
| Gene ID - Rat | ENSRNOG00000006734 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen OR2T1 (ATL-APrEST84625) | |
| Datasheet | PrEST Antigen OR2T1 (ATL-APrEST84625) Datasheet (External Link) |
| Vendor Page | PrEST Antigen OR2T1 (ATL-APrEST84625) at Atlas Antibodies |
| Documents & Links for PrEST Antigen OR2T1 (ATL-APrEST84625) | |
| Datasheet | PrEST Antigen OR2T1 (ATL-APrEST84625) Datasheet (External Link) |
| Vendor Page | PrEST Antigen OR2T1 (ATL-APrEST84625) |