PrEST Antigen NUDCD2 (ATL-APrEST87224)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST87224-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: NUDCD2
Alternative Gene Name: DKFZp686E10109
Sequence: LFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQRKLTLERFQKENPGFDFSGAEISGNYTKGGPDF
Interspecies mouse/rat: ENSMUSG00000020328: 100%, ENSRNOG00000060914: 100%
Entrez Gene ID: 134492
Uniprot ID: Q8WVJ2
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | LFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQRKLTLERFQKENPGFDFSGAEISGNYTKGGPDF |
| Gene ID - Mouse | ENSMUSG00000020328 |
| Gene ID - Rat | ENSRNOG00000060914 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen NUDCD2 (ATL-APrEST87224) | |
| Datasheet | PrEST Antigen NUDCD2 (ATL-APrEST87224) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NUDCD2 (ATL-APrEST87224) at Atlas Antibodies |
| Documents & Links for PrEST Antigen NUDCD2 (ATL-APrEST87224) | |
| Datasheet | PrEST Antigen NUDCD2 (ATL-APrEST87224) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NUDCD2 (ATL-APrEST87224) |