PrEST Antigen NMNAT1 (ATL-APrEST86322)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST86322-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: NMNAT1
Alternative Gene Name: NMNAT, PNAT1
Sequence: LIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQD
Interspecies mouse/rat: ENSMUSG00000028992: 72%, ENSRNOG00000015962: 75%
Entrez Gene ID: 64802
Uniprot ID: Q9HAN9
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | LIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQD |
| Gene ID - Mouse | ENSMUSG00000028992 |
| Gene ID - Rat | ENSRNOG00000015962 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen NMNAT1 (ATL-APrEST86322) | |
| Datasheet | PrEST Antigen NMNAT1 (ATL-APrEST86322) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NMNAT1 (ATL-APrEST86322) at Atlas Antibodies |
| Documents & Links for PrEST Antigen NMNAT1 (ATL-APrEST86322) | |
| Datasheet | PrEST Antigen NMNAT1 (ATL-APrEST86322) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NMNAT1 (ATL-APrEST86322) |