PrEST Antigen NDUFV1 (ATL-APrEST93266)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST93266-100
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: NDUFV1
Alternative Gene Name: CI-51K
Sequence: DFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNH
Interspecies mouse/rat: ENSMUSG00000037916: 100%, ENSRNOG00000018117: 100%
Entrez Gene ID: 4723
Uniprot ID: P49821
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | DFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNH |
| Gene ID - Mouse | ENSMUSG00000037916 |
| Gene ID - Rat | ENSMUSG00000037916 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen NDUFV1 (ATL-APrEST93266) | |
| Datasheet | PrEST Antigen NDUFV1 (ATL-APrEST93266) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NDUFV1 (ATL-APrEST93266) at Atlas Antibodies |
| Documents & Links for PrEST Antigen NDUFV1 (ATL-APrEST93266) | |
| Datasheet | PrEST Antigen NDUFV1 (ATL-APrEST93266) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NDUFV1 (ATL-APrEST93266) |