PrEST Antigen NCAM1 (ATL-APrEST87341)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST87341-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: NCAM1
Alternative Gene Name: CD56, NCAM
Sequence: DSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAK
Interspecies mouse/rat: ENSMUSG00000039542: 93%, ENSRNOG00000031890: 94%
Entrez Gene ID: 4684
Uniprot ID: P13591
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | DSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAK |
| Gene ID - Mouse | ENSMUSG00000039542 |
| Gene ID - Rat | ENSRNOG00000031890 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen NCAM1 (ATL-APrEST87341) | |
| Datasheet | PrEST Antigen NCAM1 (ATL-APrEST87341) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NCAM1 (ATL-APrEST87341) at Atlas Antibodies |
| Documents & Links for PrEST Antigen NCAM1 (ATL-APrEST87341) | |
| Datasheet | PrEST Antigen NCAM1 (ATL-APrEST87341) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NCAM1 (ATL-APrEST87341) |