PrEST Antigen NAGK (ATL-APrEST87111)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST87111-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: NAGK
Alternative Gene Name: GNK
Sequence: SEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSE
Interspecies mouse/rat: ENSMUSG00000034744: 87%, ENSRNOG00000013911: 88%
Entrez Gene ID: 55577
Uniprot ID: Q9UJ70
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | SEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSE |
| Gene ID - Mouse | ENSMUSG00000034744 |
| Gene ID - Rat | ENSRNOG00000013911 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen NAGK (ATL-APrEST87111) | |
| Datasheet | PrEST Antigen NAGK (ATL-APrEST87111) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NAGK (ATL-APrEST87111) at Atlas Antibodies |
| Documents & Links for PrEST Antigen NAGK (ATL-APrEST87111) | |
| Datasheet | PrEST Antigen NAGK (ATL-APrEST87111) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NAGK (ATL-APrEST87111) |