PrEST Antigen MCUB (ATL-APrEST85246)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST85246-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: MCUB
Alternative Gene Name: FLJ20647
Sequence: SNEHTAEMEHMKSLVHRLFTILHLEESQKKREHHLLEKIDHLKEQLQPLEQVKAGIEAHSE
Interspecies mouse/rat: ENSMUSG00000027994: 75%, ENSRNOG00000009433: 74%
Entrez Gene ID: 55013
Uniprot ID: Q9NWR8
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | SNEHTAEMEHMKSLVHRLFTILHLEESQKKREHHLLEKIDHLKEQLQPLEQVKAGIEAHSE |
Gene ID - Mouse | ENSMUSG00000027994 |
Gene ID - Rat | ENSRNOG00000009433 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen MCUB (ATL-APrEST85246) | |
Datasheet | PrEST Antigen MCUB (ATL-APrEST85246) Datasheet (External Link) |
Vendor Page | PrEST Antigen MCUB (ATL-APrEST85246) at Atlas Antibodies |
Documents & Links for PrEST Antigen MCUB (ATL-APrEST85246) | |
Datasheet | PrEST Antigen MCUB (ATL-APrEST85246) Datasheet (External Link) |
Vendor Page | PrEST Antigen MCUB (ATL-APrEST85246) |