PrEST Antigen IL2RB (ATL-APrEST86374)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST86374-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: IL2RB
Alternative Gene Name: CD122, IL15RB
Sequence: DRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQ
Interspecies mouse/rat: ENSMUSG00000068227: 53%, ENSRNOG00000048636: 60%
Entrez Gene ID: 3560
Uniprot ID: P14784
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | DRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQ |
| Gene ID - Mouse | ENSMUSG00000068227 |
| Gene ID - Rat | ENSRNOG00000048636 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen IL2RB (ATL-APrEST86374) | |
| Datasheet | PrEST Antigen IL2RB (ATL-APrEST86374) Datasheet (External Link) |
| Vendor Page | PrEST Antigen IL2RB (ATL-APrEST86374) at Atlas Antibodies |
| Documents & Links for PrEST Antigen IL2RB (ATL-APrEST86374) | |
| Datasheet | PrEST Antigen IL2RB (ATL-APrEST86374) Datasheet (External Link) |
| Vendor Page | PrEST Antigen IL2RB (ATL-APrEST86374) |