PrEST Antigen GMEB1 (ATL-APrEST84611)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST84611-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: GMEB1
Alternative Gene Name: P96PIF, PIF96
Sequence: NVVLMPVSTPKPPKRPRLQRPASTTVLSPSPPVQQPQFTVISPITITPVGQSFSMGNIPVATLSQGSSPVTVHTLPSGPQLFRYATVVSS
Interspecies mouse/rat: ENSMUSG00000028901: 99%, ENSRNOG00000010910: 98%
Entrez Gene ID: 10691
Uniprot ID: Q9Y692
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | NVVLMPVSTPKPPKRPRLQRPASTTVLSPSPPVQQPQFTVISPITITPVGQSFSMGNIPVATLSQGSSPVTVHTLPSGPQLFRYATVVSS |
| Gene ID - Mouse | ENSMUSG00000028901 |
| Gene ID - Rat | ENSRNOG00000010910 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen GMEB1 (ATL-APrEST84611) | |
| Datasheet | PrEST Antigen GMEB1 (ATL-APrEST84611) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GMEB1 (ATL-APrEST84611) at Atlas Antibodies |
| Documents & Links for PrEST Antigen GMEB1 (ATL-APrEST84611) | |
| Datasheet | PrEST Antigen GMEB1 (ATL-APrEST84611) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GMEB1 (ATL-APrEST84611) |