PrEST Antigen GLTP (ATL-APrEST85962)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST85962-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: GLTP
Alternative Gene Name:
Sequence: ALLAEHLLKPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISG
Interspecies mouse/rat: ENSMUSG00000011884: 96%, ENSRNOG00000001192: 96%
Entrez Gene ID: 51228
Uniprot ID: Q9NZD2
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | ALLAEHLLKPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISG |
| Gene ID - Mouse | ENSMUSG00000011884 |
| Gene ID - Rat | ENSRNOG00000001192 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen GLTP (ATL-APrEST85962) | |
| Datasheet | PrEST Antigen GLTP (ATL-APrEST85962) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GLTP (ATL-APrEST85962) at Atlas Antibodies |
| Documents & Links for PrEST Antigen GLTP (ATL-APrEST85962) | |
| Datasheet | PrEST Antigen GLTP (ATL-APrEST85962) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GLTP (ATL-APrEST85962) |