PrEST Antigen GAPDHS (ATL-APrEST82591)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST82591-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: GAPDHS
Alternative Gene Name: GAPD2, GAPDH-2, GAPDS
Sequence: KYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVIS
Interspecies mouse/rat: ENSMUSG00000061099: 75%, ENSRNOG00000021009: 75%
Entrez Gene ID: 26330
Uniprot ID: O14556
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | KYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVIS |
| Gene ID - Mouse | ENSMUSG00000061099 |
| Gene ID - Rat | ENSRNOG00000021009 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen GAPDHS (ATL-APrEST82591) | |
| Datasheet | PrEST Antigen GAPDHS (ATL-APrEST82591) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GAPDHS (ATL-APrEST82591) at Atlas Antibodies |
| Documents & Links for PrEST Antigen GAPDHS (ATL-APrEST82591) | |
| Datasheet | PrEST Antigen GAPDHS (ATL-APrEST82591) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GAPDHS (ATL-APrEST82591) |