PrEST Antigen GABRB1 (ATL-APrEST85642)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST85642-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: GABRB1
Alternative Gene Name:
Sequence: IFFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNI
Interspecies mouse/rat: ENSMUSG00000029212: 97%, ENSRNOG00000002327: 100%
Entrez Gene ID: 2560
Uniprot ID: P18505
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | IFFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNI |
| Gene ID - Mouse | ENSMUSG00000029212 |
| Gene ID - Rat | ENSRNOG00000002327 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen GABRB1 (ATL-APrEST85642) | |
| Datasheet | PrEST Antigen GABRB1 (ATL-APrEST85642) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GABRB1 (ATL-APrEST85642) at Atlas Antibodies |
| Documents & Links for PrEST Antigen GABRB1 (ATL-APrEST85642) | |
| Datasheet | PrEST Antigen GABRB1 (ATL-APrEST85642) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GABRB1 (ATL-APrEST85642) |