PrEST Antigen GABBR1 (ATL-APrEST83906)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST83906-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: GABBR1
Alternative Gene Name: GPRC3A, hGB1a
Sequence: YKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKR
Interspecies mouse/rat: ENSMUSG00000024462: 97%, ENSRNOG00000000774: 97%
Entrez Gene ID: 2550
Uniprot ID: Q9UBS5
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | YKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKR |
| Gene ID - Mouse | ENSMUSG00000024462 |
| Gene ID - Rat | ENSRNOG00000000774 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen GABBR1 (ATL-APrEST83906) | |
| Datasheet | PrEST Antigen GABBR1 (ATL-APrEST83906) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GABBR1 (ATL-APrEST83906) at Atlas Antibodies |
| Documents & Links for PrEST Antigen GABBR1 (ATL-APrEST83906) | |
| Datasheet | PrEST Antigen GABBR1 (ATL-APrEST83906) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GABBR1 (ATL-APrEST83906) |