PrEST Antigen DTNBP1 (ATL-APrEST77271)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST77271-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: DTNBP1
Alternative Gene Name: DBND, Dysbindin, HPS7, My031
Sequence: LVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCGQCELERCKHMQSQQLENYKK
Interspecies mouse/rat: ENSMUSG00000057531: 76%, ENSRNOG00000048719: 73%
Entrez Gene ID: 84062
Uniprot ID: Q96EV8
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | LVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCGQCELERCKHMQSQQLENYKK |
| Gene ID - Mouse | ENSMUSG00000057531 |
| Gene ID - Rat | ENSRNOG00000048719 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen DTNBP1 (ATL-APrEST77271) | |
| Datasheet | PrEST Antigen DTNBP1 (ATL-APrEST77271) Datasheet (External Link) |
| Vendor Page | PrEST Antigen DTNBP1 (ATL-APrEST77271) at Atlas Antibodies |
| Documents & Links for PrEST Antigen DTNBP1 (ATL-APrEST77271) | |
| Datasheet | PrEST Antigen DTNBP1 (ATL-APrEST77271) Datasheet (External Link) |
| Vendor Page | PrEST Antigen DTNBP1 (ATL-APrEST77271) |