PrEST Antigen CMKLR1 (ATL-APrEST84612)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST84612-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: CMKLR1
Alternative Gene Name:
Sequence: QDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETG
Interspecies mouse/rat: ENSMUSG00000042190: 80%, ENSRNOG00000000704: 82%
Entrez Gene ID: 1240
Uniprot ID: Q99788
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | QDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETG |
Gene ID - Mouse | ENSMUSG00000042190 |
Gene ID - Rat | ENSRNOG00000000704 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen CMKLR1 (ATL-APrEST84612) | |
Datasheet | PrEST Antigen CMKLR1 (ATL-APrEST84612) Datasheet (External Link) |
Vendor Page | PrEST Antigen CMKLR1 (ATL-APrEST84612) at Atlas Antibodies |
Documents & Links for PrEST Antigen CMKLR1 (ATL-APrEST84612) | |
Datasheet | PrEST Antigen CMKLR1 (ATL-APrEST84612) Datasheet (External Link) |
Vendor Page | PrEST Antigen CMKLR1 (ATL-APrEST84612) |