PrEST Antigen C6orf203 (ATL-APrEST85465)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST85465-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: C6orf203
Alternative Gene Name: HSPC230, PRED31
Sequence: VRLKSNIRSTKSTKKSLQKVDEEDSDEESHHDEMSEQEEELEDDPTVVKNYKDLEKAVQSFRYDVVLKTGLDIGRNKVEDAFYK
Interspecies mouse/rat: ENSMUSG00000019797: 78%, ENSRNOG00000047118: 78%
Entrez Gene ID: 51250
Uniprot ID: Q9P0P8
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | VRLKSNIRSTKSTKKSLQKVDEEDSDEESHHDEMSEQEEELEDDPTVVKNYKDLEKAVQSFRYDVVLKTGLDIGRNKVEDAFYK |
| Gene ID - Mouse | ENSMUSG00000019797 |
| Gene ID - Rat | ENSRNOG00000047118 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen C6orf203 (ATL-APrEST85465) | |
| Datasheet | PrEST Antigen C6orf203 (ATL-APrEST85465) Datasheet (External Link) |
| Vendor Page | PrEST Antigen C6orf203 (ATL-APrEST85465) at Atlas Antibodies |
| Documents & Links for PrEST Antigen C6orf203 (ATL-APrEST85465) | |
| Datasheet | PrEST Antigen C6orf203 (ATL-APrEST85465) Datasheet (External Link) |
| Vendor Page | PrEST Antigen C6orf203 (ATL-APrEST85465) |