PrEST Antigen C3orf22 (ATL-APrEST84153)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST84153-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: C3orf22
Alternative Gene Name: MGC34728
Sequence: SSACKKSHQSKKWRIQAQENFAKKFPYRLSWLTEPDPEPLQPWEVTNDSNTVQLPLQKRLVPTRSIPVRGLGAPDFT
Interspecies mouse/rat: ENSMUSG00000049694: 49%, ENSRNOG00000025934: 56%
Entrez Gene ID: 152065
Uniprot ID: Q8N5N4
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | SSACKKSHQSKKWRIQAQENFAKKFPYRLSWLTEPDPEPLQPWEVTNDSNTVQLPLQKRLVPTRSIPVRGLGAPDFT |
Gene ID - Mouse | ENSMUSG00000049694 |
Gene ID - Rat | ENSRNOG00000025934 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen C3orf22 (ATL-APrEST84153) | |
Datasheet | PrEST Antigen C3orf22 (ATL-APrEST84153) Datasheet (External Link) |
Vendor Page | PrEST Antigen C3orf22 (ATL-APrEST84153) at Atlas Antibodies |
Documents & Links for PrEST Antigen C3orf22 (ATL-APrEST84153) | |
Datasheet | PrEST Antigen C3orf22 (ATL-APrEST84153) Datasheet (External Link) |
Vendor Page | PrEST Antigen C3orf22 (ATL-APrEST84153) |