PrEST Antigen C17orf62 (ATL-APrEST84448)
Atlas Antibodies
- SKU:
- ATL-APrEST84448-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: C17orf62
Alternative Gene Name: FLJ90469, MGC4368
Sequence: MVVLRLATGFSHPLTQSAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS
Interspecies mouse/rat: ENSMUSG00000039294: 84%, ENSRNOG00000036666: 84%
Entrez Gene ID: 79415
Uniprot ID: Q9BQA9
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | MVVLRLATGFSHPLTQSAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS |
Gene ID - Mouse | ENSMUSG00000039294 |
Gene ID - Rat | ENSRNOG00000036666 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen C17orf62 (ATL-APrEST84448) | |
Datasheet | PrEST Antigen C17orf62 (ATL-APrEST84448) Datasheet (External Link) |
Vendor Page | PrEST Antigen C17orf62 (ATL-APrEST84448) at Atlas Antibodies |
Documents & Links for PrEST Antigen C17orf62 (ATL-APrEST84448) | |
Datasheet | PrEST Antigen C17orf62 (ATL-APrEST84448) Datasheet (External Link) |
Vendor Page | PrEST Antigen C17orf62 (ATL-APrEST84448) |