PrEST Antigen BTBD18 (ATL-APrEST84722)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST84722-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: BTBD18
Alternative Gene Name:
Sequence: MPSEVSEVLSVGGRWTPDLEITSSQPLDGQEDKLLHVSSLDTPQRSYGDLSPPCSNWVETGLEVSLTTDELLYPSPKAGKEVSGHSELLGSLPASS
Interspecies mouse/rat: ENSMUSG00000086598: 68%, ENSRNOG00000043106: 68%
Entrez Gene ID: 643376
Uniprot ID: B2RXH4
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | MPSEVSEVLSVGGRWTPDLEITSSQPLDGQEDKLLHVSSLDTPQRSYGDLSPPCSNWVETGLEVSLTTDELLYPSPKAGKEVSGHSELLGSLPASS |
Gene ID - Mouse | ENSMUSG00000086598 |
Gene ID - Rat | ENSRNOG00000043106 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen BTBD18 (ATL-APrEST84722) | |
Datasheet | PrEST Antigen BTBD18 (ATL-APrEST84722) Datasheet (External Link) |
Vendor Page | PrEST Antigen BTBD18 (ATL-APrEST84722) at Atlas Antibodies |
Documents & Links for PrEST Antigen BTBD18 (ATL-APrEST84722) | |
Datasheet | PrEST Antigen BTBD18 (ATL-APrEST84722) Datasheet (External Link) |
Vendor Page | PrEST Antigen BTBD18 (ATL-APrEST84722) |