PrEST Antigen BTBD18 (ATL-APrEST84722)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST84722-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: BTBD18
Alternative Gene Name:
Sequence: MPSEVSEVLSVGGRWTPDLEITSSQPLDGQEDKLLHVSSLDTPQRSYGDLSPPCSNWVETGLEVSLTTDELLYPSPKAGKEVSGHSELLGSLPASS
Interspecies mouse/rat: ENSMUSG00000086598: 68%, ENSRNOG00000043106: 68%
Entrez Gene ID: 643376
Uniprot ID: B2RXH4
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | MPSEVSEVLSVGGRWTPDLEITSSQPLDGQEDKLLHVSSLDTPQRSYGDLSPPCSNWVETGLEVSLTTDELLYPSPKAGKEVSGHSELLGSLPASS |
| Gene ID - Mouse | ENSMUSG00000086598 |
| Gene ID - Rat | ENSRNOG00000043106 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen BTBD18 (ATL-APrEST84722) | |
| Datasheet | PrEST Antigen BTBD18 (ATL-APrEST84722) Datasheet (External Link) |
| Vendor Page | PrEST Antigen BTBD18 (ATL-APrEST84722) at Atlas Antibodies |
| Documents & Links for PrEST Antigen BTBD18 (ATL-APrEST84722) | |
| Datasheet | PrEST Antigen BTBD18 (ATL-APrEST84722) Datasheet (External Link) |
| Vendor Page | PrEST Antigen BTBD18 (ATL-APrEST84722) |