Anti ZWINT pAb (ATL-HPA005757)

Atlas Antibodies

Catalog No.: ATL-HPA005757-25

Protein Description: ZW10 interacting kinetochore protein
Gene Name: ZWINT
Alternative Gene Name: KNTC2AP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019923: 30%, ENSRNOG00000048682: 31%
Entrez Gene ID: 11130
Uniprot ID: O95229
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVRERKTGTQQELDGVFQKLGNLKQQAEQERDKLQRYQTFLQLLYTLQGKLLFPEAEAEAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVN
• Gene Sequence: EVRERKTGTQQELDGVFQKLGNLKQQAEQERDKLQRYQTFLQLLYTLQGKLLFPEAEAEAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVN
• Gene ID - Mouse: ENSMUSG00000019923
• Gene ID - Rat: ENSRNOG00000048682
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZWINT pAb (ATL-HPA005757) – 1 Found

Yang, Xiao-Yu; Wu, Bin; Ma, Sen-Lin; Yin, Lei; Wu, Meng-Chao; Li, Ai-Jun. Decreased Expression of ZWINT is Associated With Poor Prognosis in Patients With HCC After Surgery. Technology In Cancer Research & Treatment. 2018;17( 30198401):1533033818794190.