Anti ZNF891 pAb (ATL-HPA040301)

Atlas Antibodies

Catalog No.:
ATL-HPA040301-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 891
Gene Name: ZNF891
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057551: 28%, ENSRNOG00000005369: 27%
Entrez Gene ID: 101060200
Uniprot ID: A8MT65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTSVEYQLYRLTVISPLDQEEIRNMKKRIPQAICPDQKIQPKTKESTVQKILWEEPSNAVKMIKLTMHNWSSTLREDWECH
Gene Sequence LTSVEYQLYRLTVISPLDQEEIRNMKKRIPQAICPDQKIQPKTKESTVQKILWEEPSNAVKMIKLTMHNWSSTLREDWECH
Gene ID - Mouse ENSMUSG00000057551
Gene ID - Rat ENSRNOG00000005369
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF891 pAb (ATL-HPA040301)
Datasheet Anti ZNF891 pAb (ATL-HPA040301) Datasheet (External Link)
Vendor Page Anti ZNF891 pAb (ATL-HPA040301) at Atlas Antibodies

Documents & Links for Anti ZNF891 pAb (ATL-HPA040301)
Datasheet Anti ZNF891 pAb (ATL-HPA040301) Datasheet (External Link)
Vendor Page Anti ZNF891 pAb (ATL-HPA040301)