Anti ZNF844 pAb (ATL-HPA046982)

Atlas Antibodies

Catalog No.:
ATL-HPA046982-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 844
Gene Name: ZNF844
Alternative Gene Name: FLJ14959
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079038: 37%, ENSRNOG00000001323: 27%
Entrez Gene ID: 284391
Uniprot ID: Q08AG5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPHTFKCMKGLTLESNCMNLNNVKKPLDLSETFKFMKRHTLERNPIRNMEKHSTISLPFKYMQQCTEDRMPMNVKSVTKHSYLPRSFEYMQEHTLE
Gene Sequence LPHTFKCMKGLTLESNCMNLNNVKKPLDLSETFKFMKRHTLERNPIRNMEKHSTISLPFKYMQQCTEDRMPMNVKSVTKHSYLPRSFEYMQEHTLE
Gene ID - Mouse ENSMUSG00000079038
Gene ID - Rat ENSRNOG00000001323
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF844 pAb (ATL-HPA046982)
Datasheet Anti ZNF844 pAb (ATL-HPA046982) Datasheet (External Link)
Vendor Page Anti ZNF844 pAb (ATL-HPA046982) at Atlas Antibodies

Documents & Links for Anti ZNF844 pAb (ATL-HPA046982)
Datasheet Anti ZNF844 pAb (ATL-HPA046982) Datasheet (External Link)
Vendor Page Anti ZNF844 pAb (ATL-HPA046982)