Anti ZNF827 pAb (ATL-HPA021166)

Atlas Antibodies

Catalog No.: ATL-HPA021166-25

Protein Description: zinc finger protein 827
Gene Name: ZNF827
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071064: 95%, ENSRNOG00000011697: 93%
Entrez Gene ID: 152485
Uniprot ID: Q17R98
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LNVQFVSHMSLHVDKEQWMFSICCTACDFVTMEEAEIKTHIGTKHTGEDRKTPSESNSPSSSSLSALSDSANSKDDSDGSQKNKGGNNLLVISVMP
• Gene Sequence: LNVQFVSHMSLHVDKEQWMFSICCTACDFVTMEEAEIKTHIGTKHTGEDRKTPSESNSPSSSSLSALSDSANSKDDSDGSQKNKGGNNLLVISVMP
• Gene ID - Mouse: ENSMUSG00000071064
• Gene ID - Rat: ENSRNOG00000011697
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZNF827 pAb (ATL-HPA021166) – 1 Found

Sievers, Quinlan L; Petzold, Georg; Bunker, Richard D; Renneville, Aline; Słabicki, Mikołaj; Liddicoat, Brian J; Abdulrahman, Wassim; Mikkelsen, Tarjei; Ebert, Benjamin L; Thomä, Nicolas H. Defining the human C2H2 zinc finger degrome targeted by thalidomide analogs through CRBN. Science (New York, N.y.). 2018;362(6414)