Anti ZNF827 pAb (ATL-HPA021166)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021166-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ZNF827
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071064: 95%, ENSRNOG00000011697: 93%
Entrez Gene ID: 152485
Uniprot ID: Q17R98
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LNVQFVSHMSLHVDKEQWMFSICCTACDFVTMEEAEIKTHIGTKHTGEDRKTPSESNSPSSSSLSALSDSANSKDDSDGSQKNKGGNNLLVISVMP |
| Gene Sequence | LNVQFVSHMSLHVDKEQWMFSICCTACDFVTMEEAEIKTHIGTKHTGEDRKTPSESNSPSSSSLSALSDSANSKDDSDGSQKNKGGNNLLVISVMP |
| Gene ID - Mouse | ENSMUSG00000071064 |
| Gene ID - Rat | ENSRNOG00000011697 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF827 pAb (ATL-HPA021166) | |
| Datasheet | Anti ZNF827 pAb (ATL-HPA021166) Datasheet (External Link) |
| Vendor Page | Anti ZNF827 pAb (ATL-HPA021166) at Atlas Antibodies |
| Documents & Links for Anti ZNF827 pAb (ATL-HPA021166) | |
| Datasheet | Anti ZNF827 pAb (ATL-HPA021166) Datasheet (External Link) |
| Vendor Page | Anti ZNF827 pAb (ATL-HPA021166) |
| Citations for Anti ZNF827 pAb (ATL-HPA021166) – 1 Found |
| Sievers, Quinlan L; Petzold, Georg; Bunker, Richard D; Renneville, Aline; Słabicki, Mikołaj; Liddicoat, Brian J; Abdulrahman, Wassim; Mikkelsen, Tarjei; Ebert, Benjamin L; Thomä, Nicolas H. Defining the human C2H2 zinc finger degrome targeted by thalidomide analogs through CRBN. Science (New York, N.y.). 2018;362(6414) PubMed |