Anti ZNF792 pAb (ATL-HPA035158)

Atlas Antibodies

Catalog No.: ATL-HPA035158-25

Protein Description: zinc finger protein 792
Gene Name: ZNF792
Alternative Gene Name: FLJ38451
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033669: 33%, ENSRNOG00000026572: 34%
Entrez Gene ID: 126375
Uniprot ID: Q3KQV3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: THPRQKPFVCEAYVKGSEFSANLPRKQVQQNVHNPIRTEEGQASPVKTCRDHTSDQLSTCR
• Gene Sequence: THPRQKPFVCEAYVKGSEFSANLPRKQVQQNVHNPIRTEEGQASPVKTCRDHTSDQLSTCR
• Gene ID - Mouse: ENSMUSG00000033669
• Gene ID - Rat: ENSRNOG00000026572
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.