Anti ZNF787 pAb (ATL-HPA035140)

Atlas Antibodies

Catalog No.: ATL-HPA035140-25

Protein Description: zinc finger protein 787
Gene Name: ZNF787
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046792: 100%, ENSRNOG00000015456: 98%
Entrez Gene ID: 126208
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MELREEAWSPGPLDSEDQQMASHENPVDILIMDDDDVPSWPPTKLS
• Gene Sequence: MELREEAWSPGPLDSEDQQMASHENPVDILIMDDDDVPSWPPTKLS
• Gene ID - Mouse: ENSMUSG00000046792
• Gene ID - Rat: ENSRNOG00000015456
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.